PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Glyma.10G216400.1.p
Common NameGLYMA_10G216400, LOC100811057
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Phaseoleae; Glycine; Soja
Family NAC
Protein Properties Length: 347aa    MW: 39742.3 Da    PI: 6.7554
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Glyma.10G216400.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM172.31.5e-53191471128
                  NAM   1 lppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLpk...kvkaeekewyfFskrdkkyatgkrknratksgyWkatg 87 
                          +ppGfrFhPt++elv +yLk+k+++ k++l +vi e+d+yk+ePwd++      +++++ewyfFs++dkky+tg+r+nrat++g+Wkatg
  Glyma.10G216400.1.p  19 VPPGFRFHPTEDELVGYYLKRKINSLKIDL-DVIVEIDLYKMEPWDIQDrckLGYEQQNEWYFFSHKDKKYPTGTRTNRATAAGFWKATG 107
                          69****************************.99**************952432234677******************************* PP

                  NAM  88 kdkevlskkgelvglkktLvfykgrapkgektdWvmheyrl 128
                          +dk+v+s k++ +g++ktLvfykgrap+g+ktdW+mheyr 
  Glyma.10G216400.1.p 108 RDKAVMS-KNRIIGMRKTLVFYKGRAPNGRKTDWIMHEYRH 147
                          *******.8999***************************95 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019414.58E-6013168IPR003441NAC domain
PROSITE profilePS5100557.3719168IPR003441NAC domain
PfamPF023656.0E-2820146IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 347 aa     Download sequence    Send to blast
MSLTQIPERS SSIDMESCVP PGFRFHPTED ELVGYYLKRK INSLKIDLDV IVEIDLYKME  60
PWDIQDRCKL GYEQQNEWYF FSHKDKKYPT GTRTNRATAA GFWKATGRDK AVMSKNRIIG  120
MRKTLVFYKG RAPNGRKTDW IMHEYRHQTS EHGPPQEEGW VVCRAFRKPS PSHRPGFDHP  180
WCSTSSQQQH FFRDQIQSYS SRPLSIADIL DETNNVPHPN AEGTSFSHPF SSDHQQHLNN  240
LLSNQTVAIM DKQLIELPQL DSPTASLAIK ECNQQQHNGL TNEEYCSDER SNNSNAQGID  300
WKSLDNLFGS QLSDNAAYFS HPNLPLMMPH NHDQASHILG CFPDSS*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
3ulx_A4e-5091685168Stress-induced transcription factor NAC1
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006589457.10.0PREDICTED: NAC domain-containing protein 30-like isoform X1
SwissprotQ9C8W91e-116NAC30_ARATH; NAC domain-containing protein 30
TrEMBLI1LD760.0I1LD76_SOYBN; Uncharacterized protein
STRINGGLYMA10G36050.20.0(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF71383247
Representative plantOGRP1715800
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G71930.11e-107vascular related NAC-domain protein 7